Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Protein Wnt-8b |
|---|
Gene and Protein Information
| Gene ID | 7479 |
|---|---|
| Uniprot Accession IDs | Q93098 O00771 Q5VX55 Q8WYK9 |
| Ensembl ID | ENSP00000340677 |
| Family | Belongs to the Wnt family. |
| Sequence | MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466182 | WNT8B | Wnt family member 8B | 9598 | VGNC:9783 | OMA, EggNOG |
| Macaque | 710242 | WNT8B | Wnt family member 8B | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22423 | Wnt8b | wingless-type MMTV integration site family, member 8B | 10090 | MGI:109485 | Inparanoid, OMA, EggNOG |
| Rat | 293990 | Wnt8b | Wnt family member 8B | 10116 | RGD:1307644 | Inparanoid, OMA, EggNOG |
| Dog | 486841 | WNT8B | Wnt family member 8B | 9615 | VGNC:48430 | Inparanoid, OMA, EggNOG |
| Horse | 100070360 | WNT8B | Wnt family member 8B | 9796 | VGNC:25051 | Inparanoid, OMA |
| Cow | 538720 | WNT8B | Wnt family member 8B | 9913 | VGNC:36965 | Inparanoid, OMA |
| Pig | 100513655 | WNT8B | Wnt family member 8B | 9823 | Inparanoid, OMA | |
| Opossum | 100027787 | WNT8B | Wnt family member 8B | 13616 | Inparanoid, EggNOG | |
| Chicken | 428953 | WNT8B | Wnt family member 8B | 9031 | CGNC:53518 | Inparanoid, OMA |
| Anole lizard | 100564473 | wnt8b | Wnt family member 8B | 28377 | Inparanoid, OMA | |
| Xenopus | 100496786 | wnt8b | Wnt family member 8B | 8364 | XB-GENE-492636 | OMA, EggNOG |
| Zebrafish | 30144 | wnt8b | wingless-type MMTV integration site family, member 8b | 7955 | ZDB-GENE-990415-279 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.