🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

UBE2Z

DescripciónUbiquitin-conjugating enzyme E2 Z

Gene and Protein Information

Gene ID65264
Uniprot Accession IDs Q9H832 A6N8M6 A6NC60 Q7L354 Q8TCM4 Q9H893
Ensembl ID ENSP00000354201
Symbol USE1 HOYS7
FamilyBelongs to the ubiquitin-conjugating enzyme family.
Sequence
MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp455196UBE2Zubiquitin conjugating enzyme E2 Z9598VGNC:9762OMA, EggNOG
Mouse268470Ube2zubiquitin-conjugating enzyme E2Z10090MGI:1343160Inparanoid, OMA, EggNOG
Rat303478Ube2zubiquitin-conjugating enzyme E2Z10116RGD:1308347Inparanoid, OMA, EggNOG
Dog491062UBE2Zubiquitin conjugating enzyme E2 Z9615VGNC:48067Inparanoid, OMA
Horse100069535UBE2Zubiquitin conjugating enzyme E2 Z9796VGNC:24729Inparanoid, OMA, EggNOG
Cow100138178UBE2Zubiquitin conjugating enzyme E2 Z9913VGNC:36598Inparanoid, OMA, EggNOG
Pig100523993UBE2Zubiquitin conjugating enzyme E2 Z9823OMA, EggNOG
Opossum100021140UBE2Zubiquitin conjugating enzyme E2 Z13616Inparanoid, OMA
Chicken419991UBE2Zubiquitin conjugating enzyme E2 Z9031CGNC:899Inparanoid, OMA
Anole lizard100552398ube2zubiquitin conjugating enzyme E2 Z28377Inparanoid, OMA
Xenopus493338ube2zubiquitin conjugating enzyme E2Z8364XB-GENE-990986Inparanoid, OMA
Zebrafish436602ube2zubiquitin-conjugating enzyme E2Z7955ZDB-GENE-040718-15Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.