🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ZNRF2

DescripciónE3 ubiquitin-protein ligase ZNRF2

Gene and Protein Information

Gene ID223082
Uniprot Accession IDs Q8NHG8
Ensembl ID ENSP00000323879
Symbol RNF202 RNF202
Sequence
MGAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPSASGGAAAAAAAPAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp463326ZNRF2zinc and ring finger 29598VGNC:14124OMA, EggNOG
Macaque698413ZNRF2zinc and ring finger 29544OMA, EggNOG
Mouse387524Znrf2zinc and ring finger 210090MGI:1196246Inparanoid, OMA, EggNOG
Rat362367Znrf2zinc and ring finger 210116RGD:1306645Inparanoid, OMA, EggNOG
Cow615645ZNRF2zinc and ring finger 29913VGNC:37364Inparanoid, OMA, EggNOG
Opossum100032540ZNRF2zinc and ring finger 213616Inparanoid, OMA, EggNOG
Anole lizard100558877znrf2zinc and ring finger 228377Inparanoid, OMA
Zebrafish767761znrf2bzinc and ring finger 2b7955ZDB-GENE-060929-24Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.