🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CTNNBIP1

DescripciónBeta-catenin-interacting protein 1

Gene and Protein Information

Gene ID56998
Uniprot Accession IDs Q9NSA3 Q5T4V2
Ensembl ID ENSP00000366474
Symbol ICAT ICAT
FamilyBelongs to the CTNNBIP1 family.
Sequence
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse67087Ctnnbip1catenin beta interacting protein 110090MGI:1915756Inparanoid, OMA, EggNOG
Rat503000Ctnnbip1catenin, beta-interacting protein 110116RGD:1562749Inparanoid, OMA, EggNOG
Dog479600LOC479600beta-catenin-interacting protein 19615OMA, EggNOG
Horse100630146CTNNBIP1catenin beta interacting protein 19796VGNC:50681Inparanoid, OMA, EggNOG
Cow614630CTNNBIP1catenin beta interacting protein 19913VGNC:27803Inparanoid, OMA, EggNOG
Opossum100024685CTNNBIP1catenin beta interacting protein 113616Inparanoid, OMA, EggNOG
Platypus100090884CTNNBIP1catenin beta interacting protein 19258Inparanoid, OMA, EggNOG
Chicken771460CTNNBIP1catenin beta interacting protein 19031CGNC:66666Inparanoid, OMA
Anole lizard100551881ctnnbip1catenin beta interacting protein 128377Inparanoid, OMA, EggNOG
Xenopus493465ctnnbip1catenin beta interacting protein 18364XB-GENE-486352Inparanoid, OMA, EggNOG
Zebrafish58117ctnnbip1catenin, beta interacting protein 17955ZDB-GENE-000906-3Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.