🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

UBE2M

DescripciónNEDD8-conjugating enzyme Ubc12

Gene and Protein Information

Gene ID9040
Uniprot Accession IDs P61081 O76069 Q8VC50
Ensembl ID ENSP00000253023
Symbol UBC12 UBC12 hUbc12 UBC-RS2
FamilyBelongs to the ubiquitin-conjugating enzyme family. UBC12 subfamily.
Sequence
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse22192Ube2mubiquitin-conjugating enzyme E2M10090MGI:108278Inparanoid, OMA, EggNOG
Rat361509Ube2mubiquitin-conjugating enzyme E2M10116RGD:1307614Inparanoid, OMA
Dog484221UBE2Mubiquitin conjugating enzyme E2 M9615VGNC:48059Inparanoid, OMA, EggNOG
Horse100064883UBE2Mubiquitin conjugating enzyme E2 M9796VGNC:24724Inparanoid, OMA, EggNOG
Cow613343UBE2Mubiquitin conjugating enzyme E2 M9913VGNC:36589Inparanoid, OMA, EggNOG
Anole lizard100561385ube2mubiquitin conjugating enzyme E2 M28377Inparanoid, OMA, EggNOG
Xenopus394553ube2mubiquitin conjugating enzyme E2M8364XB-GENE-1005525Inparanoid, OMA, EggNOG
Fruitfly38916UbcE2MUbiquitin conjugating enzyme E2M7227FBgn0035853Inparanoid, EggNOG
S.cerevisiae851015UBC12NEDD8-conjugating protein UBC124932S000004297Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.