🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

UCHL5

DescripciónUbiquitin carboxyl-terminal hydrolase isozyme L5

Gene and Protein Information

Gene ID51377
Uniprot Accession IDs Q9Y5K5 Q5LJA6 Q5LJA7 Q8TBS4 Q96BJ9 Q9H1W5 Q9P0I3 Q9UQN2 UCH-L5
Ensembl ID ENSP00000356425
Symbol UCH37 UCH37 CGI-70 INO80R UCH-L5
FamilyBelongs to the peptidase C12 family.
Sequence
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457596UCHL5ubiquitin C-terminal hydrolase L59598VGNC:10906OMA, EggNOG
Mouse56207Uchl5ubiquitin carboxyl-terminal esterase L510090MGI:1914848Inparanoid, OMA, EggNOG
Rat360853Uchl5ubiquitin C-terminal hydrolase L510116RGD:1305414Inparanoid, OMA, EggNOG
Dog478958UCHL5ubiquitin C-terminal hydrolase L59615VGNC:48105Inparanoid, OMA, EggNOG
HorseUCHL5ubiquitin C-terminal hydrolase L5 [Source:HGNC Symbol;Acc:HGNC:19678]9796OMA, EggNOG
Cow282110UCHL5ubiquitin C-terminal hydrolase L59913VGNC:36633Inparanoid, OMA, EggNOG
Pig100144472UCHL5ubiquitin C-terminal hydrolase L59823Inparanoid, OMA, EggNOG
PlatypusUCHL5ubiquitin C-terminal hydrolase L5 [Source:HGNC Symbol;Acc:HGNC:19678]9258OMA, EggNOG
Chicken424359UCHL5ubiquitin C-terminal hydrolase L59031CGNC:1810Inparanoid, OMA
Anole lizard100561706uchl5ubiquitin C-terminal hydrolase L528377Inparanoid, OMA, EggNOG
Xenopus100124308uchl5ubiquitin C-terminal hydrolase L58364XB-GENE-968743Inparanoid, OMA, EggNOG
Zebrafish406357uchl5ubiquitin carboxyl-terminal hydrolase L57955ZDB-GENE-040426-2051Inparanoid, OMA
C. elegans174289ubh-4Probable ubiquitin carboxyl-terminal hydrolase ubh-46239Inparanoid, OMA
Fruitfly39102Uch-L5Ubiquitin carboxy-terminal hydrolase L57227FBgn0011327Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.