🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

UBE2N

DescripciónUbiquitin-conjugating enzyme E2 N

Gene and Protein Information

Gene ID7334
Uniprot Accession IDs P61088 Q16781 Q53Y81
Ensembl ID ENSP00000316176
Symbol BLU UBC13 UbcH13 HEL-S-71 UbcH-ben UBCHBEN; UBC13
FamilyBelongs to the ubiquitin-conjugating enzyme family.
Sequence
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452125UBE2Nubiquitin conjugating enzyme E2 N9598VGNC:5641OMA, EggNOG
Macaque715437UBE2Nubiquitin conjugating enzyme E2 N9544Inparanoid, OMA
Mouse93765Ube2nubiquitin-conjugating enzyme E2N10090MGI:1934835Inparanoid, OMA, EggNOG
Rat116725Ube2nubiquitin-conjugating enzyme E2N10116RGD:621096Inparanoid, OMA
Horse102150222LOC102150222ubiquitin-conjugating enzyme E2 N9796OMA, EggNOG
Cow541130UBE2Nubiquitin conjugating enzyme E2 N9913VGNC:36590Inparanoid, OMA, EggNOG
Opossum100011853UBE2Nubiquitin conjugating enzyme E2 N13616Inparanoid, OMA, EggNOG
Anole lizard100560649ube2nubiquitin conjugating enzyme E2 N28377OMA, EggNOG
Xenopus395006ube2nubiquitin conjugating enzyme E2 N8364XB-GENE-943749Inparanoid, OMA, EggNOG
Zebrafish393313ube2nbubiquitin-conjugating enzyme E2Nb7955ZDB-GENE-040426-1291Inparanoid, OMA, EggNOG
C. elegans177073ubc-13Ubiquitin-conjugating enzyme E2 136239OMA, EggNOG
S.cerevisiae851666UBC13E2 ubiquitin-conjugating protein UBC134932S000002499OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.