🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

UCHL3

DescripciónUbiquitin carboxyl-terminal hydrolase isozyme L3

Gene and Protein Information

Gene ID7347
Uniprot Accession IDs P15374 B2R970 Q5TBK8 Q6IBE9 UCH-L3
Ensembl ID ENSP00000366819
Symbol UCH-L3
FamilyBelongs to the peptidase C12 family.
Sequence
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
ChimpUCHL3ubiquitin C-terminal hydrolase L39598VGNC:14464Inparanoid, OMA
Macaque697276UCHL3ubiquitin C-terminal hydrolase L39544Inparanoid, OMA, EggNOG
Mouse50933Uchl3ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)10090MGI:1355274Inparanoid, OMA, EggNOG
RatUchl3ubiquitin C-terminal hydrolase L3 [Source:RGD Symbol;Acc:1561196]10116OMA, EggNOG
Dog476947UCHL3ubiquitin C-terminal hydrolase L39615VGNC:48104Inparanoid, OMA, EggNOG
Horse100052000UCHL3ubiquitin C-terminal hydrolase L39796VGNC:24761Inparanoid, OMA, EggNOG
Cow520170UCHL3ubiquitin C-terminal hydrolase L39913VGNC:36632Inparanoid, OMA, EggNOG
Pig768115UCHL3ubiquitin C-terminal hydrolase L39823Inparanoid, OMA, EggNOG
Opossum100012187UCHL3ubiquitin C-terminal hydrolase L313616Inparanoid, OMA, EggNOG
Chicken395626UCHL3ubiquitin C-terminal hydrolase L39031CGNC:12703Inparanoid, OMA, EggNOG
Anole lizard100556573uchl3ubiquitin C-terminal hydrolase L328377Inparanoid, OMA, EggNOG
Xenopus549874uchl3ubiquitin C-terminal hydrolase L38364XB-GENE-980858Inparanoid, OMA, EggNOG
Zebrafish554104uchl3ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)7955ZDB-GENE-050522-158Inparanoid, OMA, EggNOG
C. elegans179039ubh-1Ubiquitin carboxyl-terminal hydrolase6239OMA, EggNOG
S.cerevisiae853562YUH1ubiquitin-specific protease YUH14932S000003860OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.