VAMP2

DescripciónVesicle-associated membrane protein 2

Gene and Protein Information

Gene ID6844
Uniprot Accession IDs P63027 P19065 Q9BUC2 VAMP-2
Ensembl ID ENSP00000314214
Symbol SYB2 SYB2 VAMP-2
FamilyBelongs to the synaptobrevin family.
Sequence
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque574134VAMP2vesicle associated membrane protein 29544Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.