Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Vesicle-associated membrane protein-associated protein A |
|---|
Gene and Protein Information
| Gene ID | 9218 |
|---|---|
| Uniprot Accession IDs | Q9P0L0 A6NDZ0 D3DUI3 O75453 Q5U0E7 Q9UBZ2 VAMP-A |
| Ensembl ID | ENSP00000345656 |
| Symbol | VAP33 VAP-A VAP33 VAP-33 hVAP-33 |
| Family | Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. |
| Sequence | MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 30960 | Vapa | vesicle-associated membrane protein, associated protein A | 10090 | MGI:1353561 | Inparanoid, OMA, EggNOG |
| Rat | 58857 | Vapa | VAMP associated protein A | 10116 | RGD:61803 | Inparanoid, OMA, EggNOG |
| Dog | 480208 | VAPA | VAMP associated protein A | 9615 | VGNC:48229 | Inparanoid, OMA, EggNOG |
| Cow | 516024 | VAPA | VAMP associated protein A | 9913 | VGNC:36763 | Inparanoid, OMA, EggNOG |
| Platypus | 100081514 | VAPA | VAMP associated protein A | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100557973 | vapa | VAMP associated protein A | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496796 | vapa | VAMP associated protein A | 8364 | XB-GENE-990155 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436819 | vapal | VAMP (vesicle-associated membrane protein)-associated protein A, like | 7955 | ZDB-GENE-040718-281 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / membrane traffic protein / membrane trafficking regulatory protein / Vesicle-associated membrane protein-associated protein A
protein / membrane traffic protein / membrane trafficking regulatory protein / Vesicle-associated membrane protein-associated protein A
DTO Classes
protein / Transporter / Membrane trafficking regulatory protein / Vesicle-associated membrane protein-associated protein A
protein / Transporter / Membrane trafficking regulatory protein / Vesicle-associated membrane protein-associated protein A
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.