🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

HTR5A

Descripción5-hydroxytryptamine receptor 5A

Gene and Protein Information

Gene ID3361
Uniprot Accession IDs P47898 Q2M2D2 5-HT-5
Ensembl ID ENSP00000287907
Symbol 5-HT5A
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp463837HTR5A5-hydroxytryptamine receptor 5A9598VGNC:8691OMA, EggNOG
Macaque716134HTR5A5-hydroxytryptamine receptor 5A9544Inparanoid, OMA, EggNOG
Mouse15563Htr5a5-hydroxytryptamine (serotonin) receptor 5A10090MGI:96283Inparanoid, OMA, EggNOG
Rat25689Htr5a5-hydroxytryptamine receptor 5A10116RGD:2851Inparanoid, OMA, EggNOG
Dog482814HTR5A5-hydroxytryptamine receptor 5A9615VGNC:41832Inparanoid, OMA, EggNOG
Horse100063709HTR5A5-hydroxytryptamine receptor 5A9796VGNC:18908Inparanoid, OMA
Cow541200HTR5A5-hydroxytryptamine receptor 5A9913VGNC:30001Inparanoid, OMA
Pig100154782LOC1001547825-hydroxytryptamine receptor 5B9823Inparanoid, EggNOG
OpossumHTR5A5-hydroxytryptamine receptor 5A [Source:HGNC Symbol;Acc:HGNC:5300]13616OMA, EggNOG
Chicken428409HTR5A5-hydroxytryptamine receptor 5A9031CGNC:53358Inparanoid, OMA, EggNOG
Anole lizard100556449htr5a5-hydroxytryptamine receptor 5A28377Inparanoid, OMA, EggNOG
Xenopushtr5a5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled [Source:Xenbase;Acc:XB-GENE-981825]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    5-hydroxytryptamine receptor 5a
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    5-hydroxytryptamine receptor    /    5-HT5 receptor    /    5-hydroxytryptamine receptor 5a

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.