CHRM5

DescripciónMuscarinic acetylcholine receptor M5

Gene and Protein Information

Gene ID1133
Uniprot Accession IDs P08912 Q96RG7
Ensembl ID ENSP00000372750
Symbol HM5
FamilyBelongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM5 sub-subfamily.
Sequence
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp503515CHRM5cholinergic receptor muscarinic 59598VGNC:10166Inparanoid, OMA, EggNOG
Macaque574330CHRM5cholinergic receptor muscarinic 59544Inparanoid, OMA, EggNOG
Mouse213788Chrm5cholinergic receptor, muscarinic 510090MGI:109248Inparanoid, OMA, EggNOG
Rat53949Chrm5cholinergic receptor, muscarinic 510116RGD:620027Inparanoid, OMA, EggNOG
Dog487472CHRM5cholinergic receptor muscarinic 59615VGNC:39235Inparanoid, OMA
Horse100057856CHRM5cholinergic receptor muscarinic 59796VGNC:16521Inparanoid, OMA
Cow281686CHRM5cholinergic receptor muscarinic 59913VGNC:27321Inparanoid, OMA
Chicken428881CHRM5cholinergic receptor muscarinic 59031CGNC:53502Inparanoid, OMA
Anole lizard100562127chrm5cholinergic receptor muscarinic 528377Inparanoid, OMA
Xenopus100498518chrm5cholinergic receptor, muscarinic 58364XB-GENE-986590Inparanoid, OMA
Zebrafish553978chrm5acholinergic receptor, muscarinic 5a7955ZDB-GENE-080723-32Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Muscarinic acetylcholine receptor M5
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Acetylcholine receptor (muscarinic)    /    Muscarinic acetylcholine receptor M5

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.