🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ACOT9

DescripciónAcyl-coenzyme A thioesterase 9, mitochondrial

Gene and Protein Information

Gene ID23597
Uniprot Accession IDs Q9Y305 B3KNC9 B7ZM94 Acyl-CoA thioesterase 9
Ensembl ID ENSP00000368605
Symbol ACATE2 CGI-16 MTACT48 MT-ACT48
FamilyBelongs to the acyl coenzyme A hydrolase family.
Sequence
MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVEVGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQRHFNSMSGPATLRKDYLVEP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp465537ACOT9acyl-CoA thioesterase 99598VGNC:1490OMA, EggNOG
Macaque697759ACOT9acyl-CoA thioesterase 99544OMA, EggNOG
Mouse64833Acot10acyl-CoA thioesterase 1010090MGI:1928940Inparanoid, OMA, EggNOG
Rat302640Acot9acyl-CoA thioesterase 910116RGD:1359188Inparanoid, OMA, EggNOG
Dog100856631ACOT9acyl-CoA thioesterase 99615VGNC:37520Inparanoid, OMA, EggNOG
Horse100060045ACOT9acyl-CoA thioesterase 99796VGNC:14992Inparanoid, OMA, EggNOG
Cow527845ACOT9acyl-CoA thioesterase 99913VGNC:25551Inparanoid, OMA, EggNOG
Pig100525265ACOT9acyl-CoA thioesterase 99823OMA, EggNOG
Opossum100012136ACOT9acyl-CoA thioesterase 913616Inparanoid, OMA, EggNOG
Platypus100078388ACOT9acyl-CoA thioesterase 99258Inparanoid, OMA, EggNOG
Chicken418600ACOT9acyl-CoA thioesterase 99031CGNC:12234Inparanoid, OMA, EggNOG
Anole lizard100561361acot9acyl-CoA thioesterase 928377Inparanoid, OMA, EggNOG
Xenopus100145745acot9acyl-CoA thioesterase 98364XB-GENE-943630Inparanoid, OMA, EggNOG
Zebrafish798073acot9.1acyl-CoA thioesterase 9, tandem duplicate 17955ZDB-GENE-040724-139OMA, EggNOG
Zebrafish798008acot9.2acyl-CoA thioesterase 9, tandem duplicate 27955ZDB-GENE-051113-136Inparanoid, OMA
C. elegans173471T07D3.9hypothetical protein6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    esterase    /    Acyl-coenzyme A thioesterase 9, mitochondrial
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Esterase    /    Acyl-coenzyme A thioesterase 9, mitochondrial

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.