224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Long-chain-fatty-acid--CoA ligase 5 |
|---|
Gene and Protein Information
| Gene ID | 51703 |
|---|---|
| Uniprot Accession IDs | Q9ULC5 A6GV77 D3DRB3 Q6UX44 Q9UIU4 |
| Ensembl ID | ENSP00000348429 |
| Symbol | ACS5 FACL5 ACS2 ACS5 FACL5 |
| Family | Belongs to the ATP-dependent AMP-binding enzyme family. |
| Sequence | MLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450739 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9598 | VGNC:8880 | OMA, EggNOG |
| Macaque | 696404 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9544 | OMA, EggNOG | |
| Mouse | 433256 | Acsl5 | acyl-CoA synthetase long-chain family member 5 | 10090 | MGI:1919129 | Inparanoid, OMA, EggNOG |
| Rat | 94340 | Acsl5 | acyl-CoA synthetase long-chain family member 5 | 10116 | RGD:69402 | Inparanoid, OMA, EggNOG |
| Dog | 477820 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9615 | VGNC:37535 | Inparanoid, OMA, EggNOG |
| Horse | 100059190 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9796 | VGNC:15007 | Inparanoid, OMA |
| Cow | 514159 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9913 | VGNC:25567 | Inparanoid, OMA, EggNOG |
| Platypus | 100082580 | ACSL5 | acyl-CoA synthetase long chain family member 5 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 423896 | ACSL5 | acyl-CoA synthetase long-chain family member 5 | 9031 | CGNC:52076 | Inparanoid, OMA |
| Anole lizard | 100561703 | acsl5 | acyl-CoA synthetase long chain family member 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 447860 | acsl5 | acyl-CoA synthetase long chain family member 5 | 7955 | ZDB-GENE-040912-169 | Inparanoid, OMA, EggNOG |
| C. elegans | 171643 | acs-13 | fatty Acid CoA Synthetase family | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 856734 | FAA2 | medium-chain fatty acid-CoA ligase FAA2 | 4932 | S000000817 | Inparanoid, OMA |
| S.cerevisiae | 855288 | FAA4 | long-chain fatty acid-CoA ligase FAA4 | 4932 | S000004860 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.