HTR4

Descripción5-hydroxytryptamine receptor 4

Gene and Protein Information

Gene ID3360
Uniprot Accession IDs Q13639 C4WYH4 Q546Q1 Q684M0 Q712M9 Q96KH9 Q96KI0 Q9H199 Q9NY73 Q9UBM6 Q9UBT4 Q9UE22 Q9UE23 Q9UQR6 5-HT-4
Ensembl ID ENSP00000353915
Symbol 5-HT4 5-HT4R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp462175HTR45-hydroxytryptamine receptor 49598VGNC:13511OMA, EggNOG
Macaque710046HTR45-hydroxytryptamine receptor 49544Inparanoid, OMA, EggNOG
Mouse15562Htr45 hydroxytryptamine (serotonin) receptor 410090MGI:109246Inparanoid, OMA, EggNOG
Rat25324Htr45-hydroxytryptamine receptor 410116RGD:2850Inparanoid, OMA, EggNOG
Dog489198HTR45-hydroxytryptamine receptor 49615VGNC:41831Inparanoid, OMA, EggNOG
Horse100034053HTR45-hydroxytryptamine receptor 49796VGNC:18907Inparanoid, OMA, EggNOG
Cow317708HTR45-hydroxytryptamine receptor 49913VGNC:30000Inparanoid, OMA, EggNOG
Pig397431HTR45-hydroxytryptamine receptor 49823OMA, EggNOG
Opossum100031563HTR45-hydroxytryptamine receptor 413616Inparanoid, EggNOG
Platypus100075879HTR45-hydroxytryptamine receptor 49258Inparanoid, OMA, EggNOG
Chicken416150HTR45-hydroxytryptamine receptor 49031CGNC:948Inparanoid, OMA, EggNOG
Anole lizard100558724htr45-hydroxytryptamine receptor 428377Inparanoid, OMA, EggNOG
Xenopus100493952htr45-hydroxytryptamine (serotonin) receptor 4, G protein-coupled8364XB-GENE-993770Inparanoid, OMA, EggNOG
Zebrafish101882850htr45-hydroxytryptamine receptor 47955ZDB-GENE-160114-31OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    5-hydroxytryptamine receptor 4
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    5-hydroxytryptamine receptor    /    5-HT4 receptor    /    5-hydroxytryptamine receptor 4

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.