🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PRKAG1

Descripción5'-AMP-activated protein kinase subunit gamma-1

Gene and Protein Information

Gene ID5571
Uniprot Accession IDs P54619 B4DDT7 Q8N7V9 AMPK gamma1
Ensembl ID ENSP00000323867
Symbol AMPKG
FamilyBelongs to the 5'-AMP-activated protein kinase gamma subunit family.
Sequence
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451872PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19598VGNC:8504OMA, EggNOG
Macaque709298PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19544OMA, EggNOG
Mouse19082Prkag1protein kinase, AMP-activated, gamma 1 non-catalytic subunit10090MGI:108411OMA, EggNOG
Dog486559PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19615VGNC:44972OMA, EggNOG
Horse100034096PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19796VGNC:21839OMA, EggNOG
Cow282324PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19913VGNC:33322OMA, EggNOG
Pig414426PRKAG1protein kinase AMP-activated non-catalytic subunit gamma 19823OMA, EggNOG
OpossumPRKAG1protein kinase AMP-activated non-catalytic subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:9385]13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase modulator    /    5'-AMP-activated protein kinase subunit gamma-1
DTO Classes
protein    /    Kinase    /    Protein kinase    /    CAMK group    /    CAMKL family    /    5'-AMP-activated protein kinase subunit gamma-1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.