224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | C-X-C motif chemokine 5 |
|---|
Gene and Protein Information
| Gene ID | 6374 |
|---|---|
| Uniprot Accession IDs | P42830 Q96QE1 |
| Ensembl ID | ENSP00000296027 |
| Symbol | ENA78 SCYB5 SCYB5 ENA-78 |
| Family | Belongs to the intercrine alpha (chemokine CxC) family. |
| Sequence | MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 740377 | CXCL5 | C-X-C motif chemokine ligand 5 | 9598 | VGNC:8663 | OMA, EggNOG |
| Mouse | 20311 | Cxcl5 | chemokine (C-X-C motif) ligand 5 | 10090 | MGI:1096868 | Inparanoid, OMA |
| Dog | 106557449 | LOC106557449 | alveolar macrophage chemotactic factor-like | 9615 | OMA, EggNOG | |
| Horse | 100033988 | CXCL6 | C-X-C motif chemokine ligand 6 | 9796 | OMA, EggNOG | |
| Cow | 281735 | CXCL5 | chemokine (C-X-C motif) ligand 5 | 9913 | OMA, EggNOG | |
| Pig | 396900 | AMCF-II | alveolar macrophage-derived chemotactic factor-II | 9823 | OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.