🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

TFAP2A

DescripciónTranscription factor AP-2-alpha

Gene and Protein Information

Gene ID7020
Uniprot Accession IDs P05549 Q13777 Q5TAV5 Q8N1C6 AP2-alpha
Ensembl ID ENSP00000368924
Symbol AP2TF TFAP2 AP-2 BOFS AP2TF TFAP2 AP-2alpha
FamilyBelongs to the AP-2 family.
Sequence
MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque700663TFAP2Atranscription factor AP-2 alpha9544Inparanoid, OMA
Mouse21418Tfap2atranscription factor AP-2, alpha10090MGI:104671Inparanoid, OMA
Rat306862Tfap2atranscription factor AP-2 alpha10116RGD:1310267Inparanoid, OMA
Dog488213TFAP2Atranscription factor AP-2 alpha9615VGNC:47283Inparanoid, OMA
Horse100063009TFAP2Atranscription factor AP-2 alpha9796VGNC:24028Inparanoid, OMA
Cow505849TFAP2Atranscription factor AP-2 alpha9913VGNC:35776Inparanoid, OMA
Pig100049668TFAP2Atranscription factor AP-2 alpha9823Inparanoid, OMA
Opossum100019883TFAP2Atranscription factor AP-2 alpha13616Inparanoid, OMA
Platypus100082770TFAP2Atranscription factor AP-2 alpha9258Inparanoid, OMA
Xenopus395064tfap2atto transcription factor AP-2 alpha8364XB-GENE-481201Inparanoid, OMA
Zebrafish140618tfap2atranscription factor AP-2 alpha7955ZDB-GENE-011212-6Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.