🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ANGPTL7

DescripciónAngiopoietin-related protein 7

Gene and Protein Information

Gene ID10218
Uniprot Accession IDs O43827 B2R9B2 F1T0A6 Q4ZGK4
Ensembl ID ENSP00000366015
Symbol CDT6 AngX CDT6 dJ647M16.1
Sequence
MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp735739ANGPTL7angiopoietin like 79598VGNC:87OMA, EggNOG
Macaque714204ANGPTL7angiopoietin like 79544Inparanoid, OMA, EggNOG
Mouse654812Angptl7angiopoietin-like 710090MGI:3605801Inparanoid, OMA, EggNOG
Rat102552055Angptl7angiopoietin like 710116RGD:7553363Inparanoid, OMA, EggNOG
Dog608972ANGPTL7angiopoietin like 79615VGNC:37863Inparanoid, OMA, EggNOG
Horse100051411ANGPTL7angiopoietin like 79796VGNC:15304Inparanoid, OMA, EggNOG
Cow512698ANGPTL7angiopoietin like 79913VGNC:25895Inparanoid, OMA, EggNOG
Pig100217376ANGPTL7angiopoietin like 79823Inparanoid, OMA, EggNOG
Opossum103103084ANGPTL7angiopoietin like 713616Inparanoid, OMA, EggNOG
Platypus100681152ANGPTL7angiopoietin like 79258Inparanoid, OMA, EggNOG
Chicken101750033ANGPTL7angiopoietin like 79031CGNC:69489OMA, EggNOG
Anole lizard103281090angptl7angiopoietin like 728377Inparanoid, OMA, EggNOG
Xenopus100124808angptl7angiopoietin like 78364XB-GENE-6046184Inparanoid, OMA, EggNOG
Zebrafish450053angptl7angiopoietin-like 77955ZDB-GENE-041010-175Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.