NPPB

DescripciónNatriuretic peptides B

Gene and Protein Information

Gene ID4879
Uniprot Accession IDs P16860 B0ZBE9 Q6FGY0 Q9P2Q7
Ensembl ID ENSP00000365651
Symbol BNP
FamilyBelongs to the natriuretic peptide family.
Sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469801NPPBnatriuretic peptide B9598VGNC:1418OMA, EggNOG
Mouse18158Nppbnatriuretic peptide type B10090MGI:97368Inparanoid, OMA, EggNOG
Rat25105Nppbnatriuretic peptide B10116RGD:3194Inparanoid, OMA, EggNOG
Dog487441NPPBnatriuretic peptide B9615VGNC:43926Inparanoid, OMA, EggNOG
Horse100056123NPPBnatriuretic peptide B9796VGNC:20845Inparanoid, OMA, EggNOG
Cow508734NPPBnatriuretic peptide B9913VGNC:32211Inparanoid, OMA, EggNOG
Pig396844NPPBnatriuretic peptide B9823Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.