🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

YWHAZ

Descripción14-3-3 protein zeta/delta

Gene and Protein Information

Gene ID7534
Uniprot Accession IDs P63104 A8K1N0 B7Z465 P29213 P29312 Q32P43 Q5XJ08 Q6GPI2 Q6IN74 Q6NUR9 Q6P3U9 Q86V33
Ensembl ID ENSP00000379287
Symbol HEL4 YWHAD KCIP-1 HEL-S-3 HEL-S-93 14-3-3-zeta
FamilyBelongs to the 14-3-3 family.
Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque709723YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9544Inparanoid, OMA, EggNOG
Mouse22631Ywhaztyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide10090MGI:109484Inparanoid, OMA, EggNOG
Rat25578Ywhaztyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta10116RGD:3980Inparanoid, OMA, EggNOG
Dog475864YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9615Inparanoid, OMA, EggNOG
Horse100056060YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9796VGNC:25121Inparanoid, OMA, EggNOG
Cow287022YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9913VGNC:53885Inparanoid, OMA, EggNOG
Pig780440YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9823Inparanoid, OMA, EggNOG
Opossum100030704YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta13616OMA, EggNOG
Platypus100077972YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9258OMA, EggNOG
Anole lizard100553372ywhaztyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta28377Inparanoid, OMA
Xenopus394780ywhaztyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta8364XB-GENE-970616Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.