🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

HTR1E

Descripción5-hydroxytryptamine receptor 1E

Gene and Protein Information

Gene ID3354
Uniprot Accession IDs P28566 E1P503 Q9P1Y1 5-HT-1E
Ensembl ID ENSP00000307766
Symbol 5-HT1E
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp472064HTR1E5-hydroxytryptamine receptor 1E9598VGNC:7895OMA, EggNOG
Macaque697598HTR1E5-hydroxytryptamine receptor 1E9544Inparanoid, OMA, EggNOG
Horse100065574HTR1E5-hydroxytryptamine receptor 1E9796VGNC:18901Inparanoid, OMA
Cow616356HTR1E5-hydroxytryptamine receptor 1E9913VGNC:29994Inparanoid, OMA
Opossum100025139HTR1E5-hydroxytryptamine receptor 1E13616Inparanoid, OMA
Chicken771973HTR1E5-hydroxytryptamine receptor 1E9031CGNC:11809Inparanoid, OMA
Anole lizard100557862htr1e5-hydroxytryptamine receptor 1E28377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    5-hydroxytryptamine receptor 1E
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    5-hydroxytryptamine receptor    /    5-HT1 receptor    /    5-hydroxytryptamine receptor 1E

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.