EIF4EBP1

DescripciónEukaryotic translation initiation factor 4E-binding protein 1

Gene and Protein Information

Gene ID1978
Uniprot Accession IDs Q13541 B2R502 D3DSW8 Q6IBN3 4E-BP1
Ensembl ID ENSP00000340691
Symbol BP-1 4EBP1 4E-BP1 PHAS-I
FamilyBelongs to the eIF4E-binding protein family.
Sequence
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp464114EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19598VGNC:884OMA, EggNOG
Macaque703628EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19544Inparanoid, EggNOG
Mouse13685Eif4ebp1eukaryotic translation initiation factor 4E binding protein 110090MGI:103267Inparanoid, OMA, EggNOG
Rat116636Eif4ebp1eukaryotic translation initiation factor 4E binding protein 110116RGD:620259Inparanoid, OMA, EggNOG
Dog475590EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19615VGNC:40286Inparanoid, OMA, EggNOG
Horse100057875EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19796VGNC:17505Inparanoid, OMA, EggNOG
Cow509613EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19913VGNC:28412Inparanoid, OMA, EggNOG
Pig100627508EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19823Inparanoid, EggNOG
Opossum100029774EIF4EBP1eukaryotic translation initiation factor 4E binding protein 113616Inparanoid, EggNOG
Chicken426773EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19031CGNC:2329Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    translation factor    /    Eukaryotic translation initiation factor 4E-binding protein 1
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Translation factor    /    Eukaryotic translation initiation factor 4E-binding protein 1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.