🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

AIF1

DescripciónAllograft inflammatory factor 1

Gene and Protein Information

Gene ID199
Uniprot Accession IDs P55008 A8K406 O43904 Q9UIV4 Q9UKS9 AIF-1
Ensembl ID ENSP00000365227
Symbol G1 IBA1 IBA1 IRT1 AIF-1 IRT-1
Sequence
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse11629Aif1allograft inflammatory factor 110090MGI:1343098Inparanoid, OMA
Rat29427Aif1allograft inflammatory factor 110116RGD:61924Inparanoid, OMA
Dog474841AIF1allograft inflammatory factor 19615VGNC:37735Inparanoid, OMA
Horse100050158AIF1allograft inflammatory factor 19796VGNC:15185Inparanoid, OMA, EggNOG
Cow280989AIF1allograft inflammatory factor 19913VGNC:25759Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Allograft inflammatory factor 1
protein    /    calcium-binding protein    /    annexin    /    Allograft inflammatory factor 1
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Allograft inflammatory factor 1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.