224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Adrenodoxin, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 2230 |
|---|---|
| Uniprot Accession IDs | P10109 B0YJ14 Q53YD6 |
| Ensembl ID | ENSP00000260270 |
| Symbol | ADX ADX FDX LOH11CR1D |
| Family | Belongs to the adrenodoxin/putidaredoxin family. |
| Sequence | MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451689 | FDX1 | ferredoxin 1 | 9598 | VGNC:3279 | OMA, EggNOG |
| Mouse | 14148 | Fdx1 | ferredoxin 1 | 10090 | MGI:103224 | Inparanoid, OMA, EggNOG |
| Rat | 29189 | Fdx1 | ferredoxin 1 | 10116 | RGD:62036 | Inparanoid, OMA, EggNOG |
| Dog | 100686950 | FDX1 | ferredoxin 1 | 9615 | VGNC:40813 | Inparanoid, OMA, EggNOG |
| Horse | 100630891 | FDX1 | ferredoxin 1 | 9796 | VGNC:17984 | Inparanoid, OMA, EggNOG |
| Cow | 281157 | FDX1 | ferredoxin 1 | 9913 | VGNC:54432 | Inparanoid, OMA, EggNOG |
| Opossum | 100032399 | FDX1 | ferredoxin 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | FDX1 | ferredoxin 1 [Source:HGNC Symbol;Acc:HGNC:3638] | 9258 | OMA, EggNOG | ||
| Chicken | 373947 | FDX1 | ferredoxin 1 | 9031 | CGNC:48971 | Inparanoid, OMA |
| Anole lizard | 100562546 | fdx1 | ferredoxin 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100379765 | fdx1 | ferredoxin 1 | 8364 | XB-GENE-990886 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100126232 | fdx1 | ferredoxin 1 | 7955 | ZDB-GENE-071015-2 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.