224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Apoptosis-inducing factor 1, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 9131 |
|---|---|
| Uniprot Accession IDs | O95831 A4QPB4 B1ALN1 B2RB08 D3DTE9 Q1L6K4 Q1L6K6 Q2QKE4 Q5JUZ7 Q6I9X6 Q9Y3I3 Q9Y3I4 |
| Ensembl ID | ENSP00000287295 |
| Symbol | AIF PDCD8 AIF CMT2D CMTX4 COWCK DFNX5 NADMR NAMSD PDCD8 COXPD6 |
| Family | Belongs to the FAD-dependent oxidoreductase family. |
| Sequence | MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100615914 | AIFM1 | apoptosis inducing factor mitochondria associated 1 | 9598 | VGNC:14685 | Inparanoid, OMA, EggNOG |
| Macaque | 702773 | AIFM1 | apoptosis inducing factor mitochondria associated 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 26926 | Aifm1 | apoptosis-inducing factor, mitochondrion-associated 1 | 10090 | MGI:1349419 | Inparanoid, OMA, EggNOG |
| Rat | 83533 | Aifm1 | apoptosis inducing factor, mitochondria associated 1 | 10116 | RGD:620817 | Inparanoid, OMA, EggNOG |
| Dog | 481048 | AIFM1 | apoptosis inducing factor mitochondria associated 1 | 9615 | VGNC:37737 | Inparanoid, OMA, EggNOG |
| Horse | 100054546 | AIFM1 | apoptosis inducing factor mitochondria associated 1 | 9796 | VGNC:15186 | Inparanoid, OMA, EggNOG |
| Cow | 535714 | AIFM1 | apoptosis inducing factor mitochondria associated 1 | 9913 | VGNC:25761 | Inparanoid, OMA, EggNOG |
| Pig | 100524062 | AIFM1 | apoptosis inducing factor mitochondria associated 1 | 9823 | Inparanoid, OMA | |
| Opossum | AIFM1 | apoptosis inducing factor mitochondria associated 1 [Source:HGNC Symbol;Acc:HGNC:8768] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 428688 | AIFM1 | apoptosis inducing factor, mitochondria associated 1 | 9031 | CGNC:2941 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562576 | aifm1 | apoptosis inducing factor mitochondria associated 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549998 | aifm1 | apoptosis inducing factor, mitochondria associated 1 | 8364 | XB-GENE-1016872 | Inparanoid, OMA, EggNOG |
| Zebrafish | 373125 | aifm1 | apoptosis-inducing factor, mitochondrion-associated 1 | 7955 | ZDB-GENE-030826-11 | OMA, EggNOG |
| C. elegans | 176635 | wah-1 | Worm AIF (apoptosis inducing factor) Homolog | 6239 | Inparanoid, OMA | |
| Fruitfly | 33390 | AIF | Apoptosis inducing factor | 7227 | FBgn0031392 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / oxidoreductase / oxidase / Apoptosis-inducing factor 1, mitochondrial
protein / oxidoreductase / dehydrogenase / Apoptosis-inducing factor 1, mitochondrial
protein / oxidoreductase / reductase / Apoptosis-inducing factor 1, mitochondrial
protein / oxidoreductase / oxidase / Apoptosis-inducing factor 1, mitochondrial
protein / oxidoreductase / dehydrogenase / Apoptosis-inducing factor 1, mitochondrial
protein / oxidoreductase / reductase / Apoptosis-inducing factor 1, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Dehydrogenase / Apoptosis-inducing factor 1, mitochondrial
protein / Enzyme / Oxidoreductase / Dehydrogenase / Apoptosis-inducing factor 1, mitochondrial
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.