🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GRP

DescripciónGastrin-releasing peptide

Gene and Protein Information

Gene ID2922
Uniprot Accession IDs P07492 P07491 P81553 Q14454 Q53YA0 Q9BSY7 GRP
Ensembl ID ENSP00000256857
Symbol BN GRP-10 proGRP preproGRP
FamilyBelongs to the bombesin/neuromedin-B/ranatensin family.
Sequence
MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp736808GRPgastrin releasing peptide9598VGNC:7316OMA, EggNOG
Macaque696983GRPgastrin releasing peptide9544OMA, EggNOG
Mouse225642Grpgastrin releasing peptide10090MGI:95833Inparanoid, OMA, EggNOG
Rat171101Grpgastrin releasing peptide10116RGD:621740Inparanoid, OMA, EggNOG
Dog610154GRPgastrin releasing peptide9615VGNC:53721OMA, EggNOG
Horse100050124GRPgastrin releasing peptide9796VGNC:18608Inparanoid, OMA, EggNOG
Cow615323GRPgastrin releasing peptide9913VGNC:29664Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.