🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ADPGK

DescripciónADP-dependent glucokinase

Gene and Protein Information

Gene ID83440
Uniprot Accession IDs Q9BRR6 Q49AU7 Q8NBI1 Q8WZ90 Q96NF8 Q9H0A7 ADP-GK
Ensembl ID ENSP00000312250
Symbol ADP-GK 2610017G09Rik
FamilyBelongs to the ADP-dependent glucokinase family.
Sequence
MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAAWDALIVRPVRRWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp748791ADPGKADP dependent glucokinase9598VGNC:11790OMA, EggNOG
Macaque699257ADPGKADP dependent glucokinase9544Inparanoid, OMA, EggNOG
Mouse72141AdpgkADP-dependent glucokinase10090MGI:1919391Inparanoid, OMA, EggNOG
Rat315722AdpgkADP-dependent glucokinase10116RGD:1306103Inparanoid, OMA, EggNOG
Dog478360ADPGKADP dependent glucokinase9615VGNC:37669Inparanoid, OMA, EggNOG
Horse100052166ADPGKADP dependent glucokinase9796VGNC:15128Inparanoid, OMA, EggNOG
Cow518158ADPGKADP dependent glucokinase9913VGNC:25689Inparanoid, OMA, EggNOG
Pig100623786ADPGKADP dependent glucokinase9823OMA, EggNOG
Opossum100016323ADPGKADP dependent glucokinase13616Inparanoid, EggNOG
Chicken415317ADPGKADP dependent glucokinase9031CGNC:1256Inparanoid, OMA, EggNOG
Anole lizard100567625adpgkADP dependent glucokinase28377Inparanoid, OMA, EggNOG
XenopusadpgkADP-dependent glucokinase [Source:Xenbase;Acc:XB-GENE-6037604]8364OMA, EggNOG
Zebrafish557919adpgkADP-dependent glucokinase7955ZDB-GENE-061103-421Inparanoid, OMA, EggNOG
C. elegans173393C50D2.7Probable ADP-dependent glucokinase6239Inparanoid, OMA
Fruitfly39555CG6650CG6650 gene product from transcript CG6650-RA7227FBgn0036402Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.