Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Alpha-methylacyl-CoA racemase |
|---|
Gene and Protein Information
| Gene ID | 23600 |
|---|---|
| Uniprot Accession IDs | Q9UHK6 A5YM47 B8Y916 B8Y918 F8W9N1 O43673 Q3KT79 Q96GH1 Q9Y3Q1 |
| Ensembl ID | ENSP00000371517 |
| Symbol | RM RACE CBAS4 P504S AMACRD |
| Family | Belongs to the CaiB/BaiF CoA-transferase family. |
| Sequence | MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGKGQVIDANMVEGTAYLSSFLWKTQKLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFSREEIYQLNSDKIIESNKVKASL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 698365 | AMACR | alpha-methylacyl-CoA racemase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17117 | Amacr | alpha-methylacyl-CoA racemase | 10090 | MGI:1098273 | Inparanoid, OMA, EggNOG |
| Rat | 25284 | Amacr | alpha-methylacyl-CoA racemase | 10116 | RGD:3048 | Inparanoid, OMA |
| Dog | 612603 | AMACR | alpha-methylacyl-CoA racemase | 9615 | VGNC:37824 | Inparanoid, OMA, EggNOG |
| Cow | 540376 | AMACR | alpha-methylacyl-CoA racemase | 9913 | VGNC:25856 | Inparanoid, OMA, EggNOG |
| Pig | 100512020 | AMACR | alpha-methylacyl-CoA racemase | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100015444 | AMACR | alpha-methylacyl-CoA racemase | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 427429 | AMACR | alpha-methylacyl-CoA racemase | 9031 | CGNC:53085 | Inparanoid, OMA, EggNOG |
| Xenopus | 493271 | amacr | alpha-methylacyl-CoA racemase | 8364 | XB-GENE-1009589 | Inparanoid, OMA, EggNOG |
| Zebrafish | 553653 | amacr | alpha-methylacyl-CoA racemase | 7955 | ZDB-GENE-050522-484 | OMA, EggNOG |
| C. elegans | 174559 | ZK892.4 | CaiB/baiF CoA-transferase family protein ZK892.4 | 6239 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.