🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PRNP

DescripciónAlternative prion protein

Gene and Protein Information

Gene ID5621
Uniprot Accession IDs F7VJQ1
Ensembl ID ENSP00000368752
Symbol ALTPRP PRIP PRP CJD GSS PrP ASCR KURU PRIP PrPc CD230 AltPrP p27-30 PrP27-30 PrP33-35C
Sequence
MEHWGQPIPGAGQPWRQPLPTSGRWWLGAASWWWLGAASWWWLGAAPWWWLGTASWWWLGSRRWHPQSVEQAE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque717859PRNPprion protein9544Inparanoid, OMA, EggNOG
Mouse19122Prnpprion protein10090MGI:97769Inparanoid, OMA, EggNOG
Rat24686Prnpprion protein10116RGD:3410Inparanoid, OMA, EggNOG
Dog485783PRNPprion protein9615VGNC:45004Inparanoid, OMA, EggNOG
Horse100065904PRNPprion protein9796VGNC:21868Inparanoid, OMA, EggNOG
Cow281427PRNPprion protein9913VGNC:33356Inparanoid, OMA, EggNOG
Pig494014PRNPprion protein9823Inparanoid, OMA, EggNOG
Anole lizard100555750LOC100555750major prion protein homolog28377OMA, EggNOG
Xenopus100158502prnpprion protein8364XB-GENE-952814Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.