🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ANGPTL8

DescripciónAngiopoietin-like protein 8

Gene and Protein Information

Gene ID55908
Uniprot Accession IDs Q6UXH0 Q9NQZ1
Ensembl ID ENSP00000479969
Symbol C19orf80 RIFL RIFL TD26 PRO1185 PVPA599 C19orf80
FamilyBelongs to the ANGPTL8 family.
Sequence
MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque106994638ANGPTL8angiopoietin like 89544OMA, EggNOG
Mouse624219Angptl8angiopoietin-like 810090MGI:3643534Inparanoid, OMA, EggNOG
Rat100361444Angptl8angiopoietin-like 810116RGD:2320121OMA, EggNOG
Dog102155149ANGPTL8angiopoietin like 89615VGNC:37864OMA, EggNOG
HorseANGPTL8angiopoietin like 8 [Source:HGNC Symbol;Acc:HGNC:24933]9796OMA, EggNOG
Cow101902412ANGPTL8angiopoietin like 89913VGNC:25896OMA, EggNOG
Opossum103096238ANGPTL8angiopoietin like 813616OMA, EggNOG
Platypus103170718ANGPTL8angiopoietin like 89258OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.