🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

YWHAH

Descripción14-3-3 protein eta

Gene and Protein Information

Gene ID7533
Uniprot Accession IDs Q04917
Ensembl ID ENSP00000248975
Symbol YWHA1 YWHA1
FamilyBelongs to the 14-3-3 family.
Sequence
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp458778YWHAHtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta9598VGNC:10128OMA, EggNOG
Macaque717016YWHAHtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta9544Inparanoid, OMA, EggNOG
Mouse22629Ywhahtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide10090MGI:109194Inparanoid, OMA, EggNOG
Rat25576Ywhahtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta10116RGD:3978Inparanoid, OMA
Dog100687866YWHAHtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta9615VGNC:52975Inparanoid, OMA, EggNOG
Horse100062878YWHAHtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta9796VGNC:50988Inparanoid, OMA
Opossum100016805YWHAHtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta13616Inparanoid, OMA
Platypus100073451YWHAHtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta9258Inparanoid, OMA, EggNOG
Chicken416955YWHAHtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta9031CGNC:50393Inparanoid, OMA, EggNOG
Xenopus549622ywhahtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta8364XB-GENE-949031Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.