🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

AAMP

DescripciónAngio-associated migratory cell protein

Gene and Protein Information

Gene ID14
Uniprot Accession IDs Q13685 Q8WUJ9 Q96H92
Ensembl ID ENSP00000248450
Sequence
MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSGDHKAKVFCVQRPDR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp459940AAMPangio associated migratory cell protein9598VGNC:46OMA, EggNOG
Macaque700763AAMPangio associated migratory cell protein9544Inparanoid, OMA, EggNOG
Mouse227290Aampangio-associated migratory protein10090MGI:107809Inparanoid, OMA, EggNOG
Rat301512Aampangio-associated, migratory cell protein10116RGD:1306281Inparanoid, OMA, EggNOG
Dog478908AAMPangio associated migratory cell protein9615VGNC:37412Inparanoid, OMA, EggNOG
Horse100058415AAMPangio associated migratory cell protein9796VGNC:14890Inparanoid, OMA, EggNOG
Cow767919AAMPangio associated migratory cell protein9913VGNC:25445Inparanoid, OMA, EggNOG
Opossum100011921AAMPangio associated migratory cell protein13616Inparanoid, OMA, EggNOG
Chicken769880AAMPangio associated migratory cell protein9031CGNC:8697Inparanoid, OMA
Anole lizard100553819aampangio associated migratory cell protein28377OMA, EggNOG
Xenopus100124854aampangio associated migratory cell protein8364XB-GENE-1010095Inparanoid, OMA, EggNOG
Zebrafish405874aampangio-associated, migratory cell protein7955ZDB-GENE-040426-2370Inparanoid, OMA, EggNOG
Fruitfly39624CG5114CG5114 gene product from transcript CG5114-RB7227FBgn0036460Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.