224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Alpha-1-antitrypsin |
|---|
Gene and Protein Information
| Gene ID | 5265 |
|---|---|
| Uniprot Accession IDs | P01009 A6PX14 B2RDQ8 Q0PVP5 Q13672 Q53XB8 Q5U0M1 Q7M4R2 Q86U18 Q86U19 Q96BF9 Q96ES1 Q9P1P0 Q9UCE6 Q9UCM3 |
| Ensembl ID | ENSP00000416066 |
| Symbol | AAT PI PI A1A AAT PI1 A1AT nNIF PRO2275 alpha1AT |
| Family | Belongs to the serpin family. |
| Sequence | MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 467541 | SERPINA1 | serpin family A member 1 | 9598 | OMA, EggNOG | |
| Macaque | 701361 | SERPINA1 | serpin family A member 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20704 | Serpina1e | serine (or cysteine) peptidase inhibitor, clade A, member 1E | 10090 | MGI:891967 | Inparanoid, OMA |
| Mouse | 20702 | Serpina1c | serine (or cysteine) peptidase inhibitor, clade A, member 1C | 10090 | MGI:891969 | OMA, EggNOG |
| Rat | 24648 | Serpina1 | serpin family A member 1 | 10116 | RGD:3326 | Inparanoid, OMA, EggNOG |
| Dog | 480422 | SERPINA1 | serpin family A member 1 | 9615 | VGNC:51681 | Inparanoid, OMA, EggNOG |
| Horse | 100065191 | LOC100065191 | alpha-1-antiproteinase 2-like | 9796 | Inparanoid, OMA | |
| Horse | 100065068 | LOC100065068 | alpha-1-antiproteinase 2-like | 9796 | OMA, EggNOG | |
| Cow | 280699 | SERPINA1 | serpin family A member 1 | 9913 | VGNC:53953 | Inparanoid, OMA, EggNOG |
| Pig | 397688 | SERPINA1 | serpin family A member 1 | 9823 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Enzyme modulator / Protease inhibitor / Serine protease inhibitor / Alpha-1-antitrypsin
protein / Enzyme modulator / Protease inhibitor / Serine protease inhibitor / Alpha-1-antitrypsin
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.