224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Alpha-1-acid glycoprotein 1 |
|---|
Gene and Protein Information
| Gene ID | 5004 |
|---|---|
| Uniprot Accession IDs | P02763 B7ZKQ5 Q5T539 Q5U067 Q8TC16 AGP 1 |
| Ensembl ID | ENSP00000259396 |
| Symbol | AGP1 ORM AGP1 AGP-A HEL-S-153w |
| Family | Belongs to the calycin superfamily. Lipocalin family. |
| Sequence | MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.