224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | HLA class I histocompatibility antigen, A-3 alpha chain |
|---|
Gene and Protein Information
| Gene ID | 3105 |
|---|---|
| Uniprot Accession IDs | P04439 O19546 O19756 Q65A82 Q9GJE6 Q9GJE7 Q9GJE8 Q9MYE6 Q9MYG4 Q9TPR8 |
| Ensembl ID | ENSP00000379873 |
| Symbol | HLAA HLAA |
| Family | Belongs to the MHC class I family. |
| Sequence | MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 494187 | PATR-G | MHC class Ib | 9598 | OMA, EggNOG | |
| Macaque | 106995876 | LOC106995876 | HLA class I histocompatibility antigen, A-11 alpha chain-like | 9544 | OMA, EggNOG | |
| Rat | 100364500 | LOC100364500 | RT1 class I, locus CE11-like | 10116 | RGD:2320860 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.