🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CHMP2B

DescripciónCharged multivesicular body protein 2b

Gene and Protein Information

Gene ID25978
Uniprot Accession IDs Q9UQN3 B4DJG8 Q53HC7 Q9Y4U6
Ensembl ID ENSP00000263780
Symbol DMT1 ALS17 VPS2B VPS2-2 CHMP2.5
FamilyBelongs to the SNF7 family.
Sequence
MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp735485CHMP2Bcharged multivesicular body protein 2B9598VGNC:1776OMA, EggNOG
Macaque719340CHMP2Bcharged multivesicular body protein 2B9544Inparanoid, OMA, EggNOG
Mouse68942Chmp2bcharged multivesicular body protein 2B10090MGI:1916192Inparanoid, OMA, EggNOG
Rat363720Chmp2bcharged multivesicular body protein 2B10116RGD:1306781Inparanoid, OMA, EggNOG
Dog487675CHMP2Bcharged multivesicular body protein 2B9615VGNC:39223Inparanoid, OMA, EggNOG
Horse100070130CHMP2Bcharged multivesicular body protein 2B9796VGNC:16506Inparanoid, OMA, EggNOG
Cow615954CHMP2Bcharged multivesicular body protein 2B9913VGNC:27301Inparanoid, OMA, EggNOG
Pig100516044CHMP2Bcharged multivesicular body protein 2B9823Inparanoid, OMA, EggNOG
Opossum100030296CHMP2Bcharged multivesicular body protein 2B13616Inparanoid, OMA, EggNOG
Platypus100084750CHMP2Bcharged multivesicular body protein 2B9258Inparanoid, OMA, EggNOG
Chicken418461CHMP2Bcharged multivesicular body protein 2B9031CGNC:11553Inparanoid, OMA, EggNOG
Anole lizard100552916chmp2bcharged multivesicular body protein 2B28377Inparanoid, OMA, EggNOG
Xenopus407966chmp2bcharged multivesicular body protein 2B8364XB-GENE-948820Inparanoid, OMA, EggNOG
Zebrafish405840chmp2bbcharged multivesicular body protein 2Bb7955ZDB-GENE-040426-2539Inparanoid, OMA
C. elegans182050C01A2.4hypothetical protein6239Inparanoid, OMA
Fruitfly38599CHMP2BCharged multivesicular body protein 2b7227FBgn0035589Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.