224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Speckle-type POZ protein |
|---|
Gene and Protein Information
| Gene ID | 8405 |
|---|---|
| Uniprot Accession IDs | O43791 B2R6S3 D3DTW7 Q53HJ1 |
| Ensembl ID | ENSP00000377001 |
| Symbol | TEF2 BTBD32 |
| Family | Belongs to the Tdpoz family. |
| Sequence | MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455106 | SPOP | speckle type BTB/POZ protein | 9598 | VGNC:9653 | OMA, EggNOG |
| Macaque | 699711 | SPOP | speckle type BTB/POZ protein | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20747 | Spop | speckle-type POZ protein | 10090 | MGI:1343085 | Inparanoid, OMA, EggNOG |
| Rat | 287643 | Spop | speckle type BTB/POZ protein | 10116 | RGD:1311613 | Inparanoid, OMA, EggNOG |
| Dog | 480548 | SPOP | speckle type BTB/POZ protein | 9615 | VGNC:46753 | Inparanoid, OMA, EggNOG |
| Horse | 100056116 | SPOP | speckle type BTB/POZ protein | 9796 | VGNC:23530 | Inparanoid, OMA, EggNOG |
| Cow | 530618 | SPOP | speckle type BTB/POZ protein | 9913 | VGNC:35229 | Inparanoid, OMA, EggNOG |
| Chicken | 425528 | SPOP | speckle type BTB/POZ protein | 9031 | CGNC:7549 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564527 | spop | speckle type BTB/POZ protein | 28377 | Inparanoid, OMA | |
| Xenopus | 394599 | spop | speckle type POZ protein | 8364 | XB-GENE-1003310 | Inparanoid, OMA |
| Zebrafish | 100005514 | spop | speckle-type POZ protein | 7955 | ZDB-GENE-040426-1378 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.