🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Structure A granel y personalizado
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

TRIM44

DescripciónTripartite motif-containing protein 44

Gene and Protein Information

Gene ID54765
Uniprot Accession IDs Q96DX7 D3DR14 Q96QY2 Q9UGK0
Ensembl ID ENSP00000299413
Symbol DIPB AN3 MC7 DIPB HSA249128
Sequence
MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451701TRIM44tripartite motif containing 449598VGNC:959OMA, EggNOG
Macaque717072TRIM44tripartite motif containing 449544Inparanoid, OMA, EggNOG
Mouse80985Trim44tripartite motif-containing 4410090MGI:1931835Inparanoid, OMA, EggNOG
Rat362172Trim44tripartite motif-containing 4410116RGD:1304877Inparanoid, OMA
Dog483424TRIM44tripartite motif containing 449615VGNC:47823Inparanoid, OMA, EggNOG
Cow782816TRIM44tripartite motif containing 449913VGNC:36336Inparanoid, OMA, EggNOG
Pig100524974TRIM44tripartite motif containing 449823OMA, EggNOG
Opossum100010124TRIM44tripartite motif containing 4413616OMA, EggNOG
Platypus100076825TRIM44tripartite motif containing 449258Inparanoid, OMA, EggNOG
Xenopustrim44tripartite motif containing 44 [Source:Xenbase;Acc:XB-GENE-955117]8364OMA, EggNOG
Zebrafish793099trim44tripartite motif containing 447955ZDB-GENE-050522-37Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.