224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Taste receptor type 2 member 16 |
|---|
Gene and Protein Information
| Gene ID | 50833 |
|---|---|
| Uniprot Accession IDs | Q9NYV7 A4D0X2 Q502V3 Q549U8 Q645W1 T2R16 |
| Ensembl ID | ENSP00000249284 |
| Symbol | BGLPT T2R16 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence | MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQWASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRWRILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYFLTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 494113 | TAS2R16 | taste 2 receptor member 16 | 9598 | VGNC:8769 | Inparanoid, OMA, EggNOG |
| Mouse | 387347 | Tas2r118 | taste receptor, type 2, member 118 | 10090 | MGI:2681247 | Inparanoid, OMA, EggNOG |
| Rat | 78980 | Tas2r118 | taste receptor, type 2, member 118 | 10116 | RGD:620735 | Inparanoid, OMA, EggNOG |
| Cow | 664638 | TAS2R16 | taste 2 receptor member 16 | 9913 | VGNC:35610 | Inparanoid, OMA |
| Opossum | 664658 | T2R62 | bitter taste receptor Modo-T2R62 | 13616 | Inparanoid, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 16
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 16
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.