TAS2R30

DescripciónTaste receptor type 2 member 30

Gene and Protein Information

Gene ID259293
Uniprot Accession IDs P59541 Q645X7 T2R30
Ensembl ID ENSP00000444736
Symbol TAS2R47 T2R30 T2R47 TAS2R47
FamilyBelongs to the G-protein coupled receptor T2R family.
Sequence
MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLWVLLLHWYATQLNPAFYSVEVRITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLRIKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEGNVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAIYFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRGALCVF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp100609864LOC100609864taste receptor type 2 member 30-like9598OMA, EggNOG
Dog100271744CAFA-T2R43bitter taste receptor Cafa-T2R439615OMA, EggNOG
Horse100065752LOC100065752taste receptor type 2 member 46-like9796OMA, EggNOG
Cow664639TAS2R46taste receptor, type 2, member 469913OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Taste 2 receptor    /    Taste receptor type 2 member 30

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.