224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Xaa-Pro aminopeptidase 1 |
|---|
Gene and Protein Information
| Gene ID | 7511 |
|---|---|
| Uniprot Accession IDs | Q9NQW7 A8K071 G5E9Y2 G8JLB2 O15250 Q53EX6 Q8N3Q0 Q96D23 |
| Ensembl ID | ENSP00000421566 |
| Symbol | XPNPEPL XPNPEPL1 APP1 SAMP XPNPEP XPNPEPL XPNPEPL1 |
| Family | Belongs to the peptidase M24B family. |
| Sequence | MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450726 | XPNPEP1 | X-prolyl aminopeptidase 1 | 9598 | VGNC:13057 | OMA, EggNOG |
| Macaque | 696570 | XPNPEP1 | X-prolyl aminopeptidase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 170750 | Xpnpep1 | X-prolyl aminopeptidase (aminopeptidase P) 1, soluble | 10090 | MGI:2180003 | Inparanoid, OMA |
| Rat | 170751 | Xpnpep1 | X-prolyl aminopeptidase 1 | 10116 | RGD:621274 | Inparanoid, OMA, EggNOG |
| Dog | 486880 | XPNPEP1 | X-prolyl aminopeptidase 1 | 9615 | VGNC:48457 | Inparanoid, OMA, EggNOG |
| Horse | 100069118 | XPNPEP1 | X-prolyl aminopeptidase 1 | 9796 | VGNC:25072 | Inparanoid, OMA, EggNOG |
| Cow | 513156 | XPNPEP1 | X-prolyl aminopeptidase 1 | 9913 | VGNC:36994 | Inparanoid, OMA, EggNOG |
| Pig | 100152688 | XPNPEP1 | X-prolyl aminopeptidase 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100028140 | XPNPEP1 | X-prolyl aminopeptidase 1 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100082035 | XPNPEP1 | X-prolyl aminopeptidase 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 423886 | XPNPEP1 | X-prolyl aminopeptidase (aminopeptidase P) 1, soluble | 9031 | CGNC:6466 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557349 | xpnpep1 | X-prolyl aminopeptidase 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 406253 | xpnpep1 | X-prolyl aminopeptidase (aminopeptidase P) 1, soluble | 7955 | ZDB-GENE-040426-999 | Inparanoid, OMA, EggNOG |
| Fruitfly | 35029 | ApepP | Aminopeptidase P | 7227 | FBgn0026150 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.