🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

XPNPEP2

DescripciónXaa-Pro aminopeptidase 2

Gene and Protein Information

Gene ID7512
Uniprot Accession IDs O43895 A0AV16 O75994
Ensembl ID ENSP00000360147
Symbol APP2 AEACEI
FamilyBelongs to the peptidase M24B family.
Sequence
MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAARAPDTASWASVLVVSTLAILGWSV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp465852XPNPEP2X-prolyl aminopeptidase 29598VGNC:14724OMA, EggNOG
Macaque701972XPNPEP2X-prolyl aminopeptidase 29544Inparanoid, OMA, EggNOG
Mouse170745Xpnpep2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound10090MGI:2180001Inparanoid, OMA, EggNOG
Rat117522Xpnpep2X-prolyl aminopeptidase 210116RGD:621277Inparanoid, OMA, EggNOG
Dog492124XPNPEP2X-prolyl aminopeptidase 29615VGNC:48458Inparanoid, OMA, EggNOG
Horse100059029XPNPEP2X-prolyl aminopeptidase 29796VGNC:25073Inparanoid, OMA, EggNOG
Cow504822XPNPEP2X-prolyl aminopeptidase 29913VGNC:36995Inparanoid, OMA, EggNOG
Pig445538XPNPEP2X-prolyl aminopeptidase 29823Inparanoid, OMA, EggNOG
Opossum100021640XPNPEP2X-prolyl aminopeptidase 213616Inparanoid, OMA, EggNOG
Anole lizard100563559xpnpep2X-prolyl aminopeptidase 228377Inparanoid, OMA, EggNOG
Xenopus100145559xpnpep2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound8364XB-GENE-969249Inparanoid, OMA, EggNOG
Zebrafish394007xpnpep2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound7955ZDB-GENE-040426-1151Inparanoid, OMA, EggNOG
S.cerevisiae850630FRA1Fra1p4932S000003952Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.