🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ATG4B

DescripciónCysteine protease ATG4B

Gene and Protein Information

Gene ID23192
Uniprot Accession IDs Q9Y4P1 B7WNK2 Q53NU4 Q6ZUV8 Q8WYM9 Q96K07 Q96K96 Q96SZ1 Q9Y2F2
Ensembl ID ENSP00000384259
Symbol APG4B AUTL1 KIAA0943 APG4B AUTL1
FamilyBelongs to the peptidase C54 family.
Sequence
MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp748674ATG4Bautophagy related 4B cysteine peptidase9598VGNC:99OMA, EggNOG
Macaque717813ATG4Bautophagy related 4B cysteine peptidase9544OMA, EggNOG
Mouse66615Atg4bautophagy related 4B, cysteine peptidase10090MGI:1913865Inparanoid, OMA, EggNOG
Rat316640Atg4bautophagy related 4B, cysteine peptidase10116RGD:1309664Inparanoid, OMA
Dog609599ATG4Bautophagy related 4B cysteine peptidase9615VGNC:49762Inparanoid, OMA, EggNOG
Cow408002ATG4Bautophagy related 4B cysteine peptidase9913VGNC:26258Inparanoid, OMA, EggNOG
Opossum100012560ATG4Bautophagy related 4B cysteine peptidase13616Inparanoid, OMA, EggNOG
Platypus100082445ATG4Bautophagy related 4B cysteine peptidase9258Inparanoid, OMA, EggNOG
Chicken404750ATG4Bautophagy related 4B cysteine peptidase9031CGNC:49878Inparanoid, OMA
Anole lizard100560042atg4bautophagy related 4B cysteine peptidase28377Inparanoid, OMA
Xenopus779919atg4bautophagy related 4B, cysteine peptidase8364XB-GENE-967111Inparanoid, OMA
Zebrafish448859atg4bautophagy related 4B, cysteine peptidase7955ZDB-GENE-040917-3Inparanoid, OMA
C. elegans190777atg-4.1Cysteine protease6239Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.