🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CLEC6A

DescripciónC-type lectin domain family 6 member A

Gene and Protein Information

Gene ID93978
Uniprot Accession IDs Q6EIG7 A2RUK3
Ensembl ID ENSP00000371505
Symbol CLECSF10 DECTIN2 CLEC4N CLECSF10 dectin-2
Sequence
MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp735479CLEC6AC-type lectin domain containing 6A9598VGNC:8378OMA, EggNOG
Macaque716162CLEC6AC-type lectin domain containing 6A9544Inparanoid, OMA, EggNOG
Mouse56620Clec4nC-type lectin domain family 4, member n10090MGI:1861231Inparanoid, OMA
Cow514979CLEC6AC-type lectin domain containing 6A9913VGNC:27436Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    cell adhesion molecule    /    C-type lectin domain family 6 member A
protein    /    receptor    /    immunoglobulin receptor superfamily    /    C-type lectin domain family 6 member A
protein    /    receptor    /    defense/immunity protein    /    C-type lectin domain family 6 member A
protein    /    receptor    /    cytokine receptor    /    C-type lectin domain family 6 member A
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    C-type lectin domain family 6 member A

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.