🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

ATF3

DescripciónCyclic AMP-dependent transcription factor ATF-3

Gene and Protein Information

Gene ID467
Uniprot Accession IDs P18847 Q5VTZ2 Q6ICQ9 Q7Z566 Q8WYM6 cAMP-dependent transcription factor ATF-3
Ensembl ID ENSP00000344352
FamilyBelongs to the bZIP family. ATF subfamily.
Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469143ATF3activating transcription factor 39598VGNC:10546OMA, EggNOG
Macaque710832ATF3activating transcription factor 39544Inparanoid, OMA, EggNOG
Mouse11910Atf3activating transcription factor 310090MGI:109384Inparanoid, OMA, EggNOG
Rat25389Atf3activating transcription factor 310116RGD:2165Inparanoid, OMA, EggNOG
Dog612911ATF3activating transcription factor 39615VGNC:38209Inparanoid, OMA, EggNOG
Horse100050849ATF3activating transcription factor 39796VGNC:15611Inparanoid, OMA, EggNOG
Cow515266ATF3activating transcription factor 39913VGNC:26241Inparanoid, OMA, EggNOG
Pig100738612ATF3activating transcription factor 39823OMA, EggNOG
Opossum100016599ATF3activating transcription factor 313616Inparanoid, OMA, EggNOG
Platypus100075947ATF3activating transcription factor 39258Inparanoid, OMA, EggNOG
Chicken421369ATF3activating transcription factor 39031CGNC:66403Inparanoid, OMA
Anole lizard100566474atf3activating transcription factor 328377Inparanoid, OMA, EggNOG
Xenopus100494437atf3activating transcription factor 38364XB-GENE-6085251Inparanoid, OMA, EggNOG
Zebrafish393939atf3activating transcription factor 37955ZDB-GENE-040426-728Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.