Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Set1/Ash2 histone methyltransferase complex subunit ASH2 |
|---|
Gene and Protein Information
| Gene ID | 9070 |
|---|---|
| Uniprot Accession IDs | Q9UBL3 A8K7C3 D3DSW9 O60659 O60660 Q96B62 |
| Ensembl ID | ENSP00000340896 |
| Symbol | ASH2L1 ASH2 Bre2 ASH2L1 ASH2L2 |
| Sequence | MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464115 | ASH2L | ASH2 like, histone lysine methyltransferase complex subunit | 9598 | VGNC:10321 | OMA, EggNOG |
| Macaque | 699382 | ASH2L | ASH2 like histone lysine methyltransferase complex subunit | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 23808 | Ash2l | ASH2 like histone lysine methyltransferase complex subunit | 10090 | MGI:1344416 | Inparanoid, OMA, EggNOG |
| Rat | 290829 | Ash2l | ASH2 like histone lysine methyltransferase complex subunit | 10116 | RGD:1305632 | Inparanoid, OMA, EggNOG |
| Dog | 475589 | ASH2L | ASH2 like, histone lysine methyltransferase complex subunit | 9615 | VGNC:50623 | Inparanoid, OMA, EggNOG |
| Horse | 100059465 | ASH2L | ASH2 like, histone lysine methyltransferase complex subunit | 9796 | VGNC:50586 | Inparanoid, OMA, EggNOG |
| Cow | 100138350 | ASH2L | ASH2 like, histone lysine methyltransferase complex subunit | 9913 | VGNC:49156 | Inparanoid, OMA, EggNOG |
| Pig | 100627423 | ASH2L | ASH2 like histone lysine methyltransferase complex subunit | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100029781 | ASH2L | ASH2 like histone lysine methyltransferase complex subunit | 13616 | Inparanoid, EggNOG | |
| Chicken | 426774 | ASH2L | ASH2 like histone lysine methyltransferase complex subunit | 9031 | CGNC:2347 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100554381 | ash2l | ASH2 like histone lysine methyltransferase complex subunit | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100492052 | ash2l | ASH2 like, histone lysine methyltransferase complex subunit | 8364 | XB-GENE-923264 | Inparanoid, OMA, EggNOG |
| Zebrafish | 558193 | ash2l | ash2 like, histone lysine methyltransferase complex subunit | 7955 | ZDB-GENE-030131-494 | Inparanoid, OMA, EggNOG |
| C. elegans | 174838 | ash-2 | ASH histone methyltransferase complex subunit (Drosophila absent, small or homeotic discs) | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 42936 | ash2 | absent, small, or homeotic discs 2 | 7227 | FBgn0000139 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2
protein / nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2
DTO Classes
protein / Nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2
protein / Nucleic acid binding / DNA binding protein / Set1/Ash2 histone methyltransferase complex subunit ASH2
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.