Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Sodium/potassium-transporting ATPase subunit beta-3 |
|---|
Gene and Protein Information
| Gene ID | 483 |
|---|---|
| Uniprot Accession IDs | P54709 B7Z1N7 |
| Ensembl ID | ENSP00000286371 |
| Symbol | CD298 ATPB-3 |
| Family | Belongs to the X(+)/potassium ATPases subunit beta family. |
| Sequence | MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746692 | ATP1B3 | ATPase Na+/K+ transporting subunit beta 3 | 9598 | VGNC:7958 | OMA, EggNOG |
| Mouse | 11933 | Atp1b3 | ATPase, Na+/K+ transporting, beta 3 polypeptide | 10090 | MGI:107788 | Inparanoid, OMA, EggNOG |
| Rat | 25390 | Atp1b3 | ATPase Na+/K+ transporting subunit beta 3 | 10116 | RGD:2172 | Inparanoid, OMA, EggNOG |
| Dog | 477098 | ATP1B3 | ATPase Na+/K+ transporting subunit beta 3 | 9615 | VGNC:38250 | Inparanoid, OMA, EggNOG |
| Horse | 100062895 | ATP1B3 | ATPase Na+/K+ transporting subunit beta 3 | 9796 | VGNC:15647 | Inparanoid, OMA, EggNOG |
| Cow | 532844 | ATP1B3 | ATPase Na+/K+ transporting subunit beta 3 | 9913 | VGNC:26287 | Inparanoid, OMA, EggNOG |
| Pig | 100514493 | ATP1B3 | ATPase Na+/K+ transporting subunit beta 3 | 9823 | Inparanoid, OMA | |
| Chicken | 396549 | ATP1B3 | ATPase Na+/K+ transporting subunit beta 3 | 9031 | CGNC:1995 | Inparanoid, OMA |
| Anole lizard | 100556957 | atp1b3 | ATPase Na+/K+ transporting subunit beta 3 | 28377 | Inparanoid, OMA | |
| Xenopus | 394687 | atp1b3 | ATPase Na+/K+ transporting subunit beta 3 | 8364 | XB-GENE-485127 | Inparanoid, OMA |
| Zebrafish | 64272 | atp1b3b | ATPase Na+/K+ transporting subunit beta 3b | 7955 | ZDB-GENE-001127-1 | Inparanoid, OMA |
| C. elegans | 182726 | nkb-1 | Sodium/potassium-transporting ATPase subunit beta-1 | 6239 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transporter / cation transporter / Sodium/potassium-transporting ATPase subunit beta-3
protein / transporter / cation transporter / Sodium/potassium-transporting ATPase subunit beta-3
DTO Classes
protein / Transporter / P-type ATPases / Na+/K+-ATPases / Sodium/potassium-transporting ATPase subunit beta-3
protein / Transporter / P-type ATPases / Na+/K+-ATPases / Sodium/potassium-transporting ATPase subunit beta-3
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.