ATP1B3

DescripciónSodium/potassium-transporting ATPase subunit beta-3

Gene and Protein Information

Gene ID483
Uniprot Accession IDs P54709 B7Z1N7
Ensembl ID ENSP00000286371
Symbol CD298 ATPB-3
FamilyBelongs to the X(+)/potassium ATPases subunit beta family.
Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp746692ATP1B3ATPase Na+/K+ transporting subunit beta 39598VGNC:7958OMA, EggNOG
Mouse11933Atp1b3ATPase, Na+/K+ transporting, beta 3 polypeptide10090MGI:107788Inparanoid, OMA, EggNOG
Rat25390Atp1b3ATPase Na+/K+ transporting subunit beta 310116RGD:2172Inparanoid, OMA, EggNOG
Dog477098ATP1B3ATPase Na+/K+ transporting subunit beta 39615VGNC:38250Inparanoid, OMA, EggNOG
Horse100062895ATP1B3ATPase Na+/K+ transporting subunit beta 39796VGNC:15647Inparanoid, OMA, EggNOG
Cow532844ATP1B3ATPase Na+/K+ transporting subunit beta 39913VGNC:26287Inparanoid, OMA, EggNOG
Pig100514493ATP1B3ATPase Na+/K+ transporting subunit beta 39823Inparanoid, OMA
Chicken396549ATP1B3ATPase Na+/K+ transporting subunit beta 39031CGNC:1995Inparanoid, OMA
Anole lizard100556957atp1b3ATPase Na+/K+ transporting subunit beta 328377Inparanoid, OMA
Xenopus394687atp1b3ATPase Na+/K+ transporting subunit beta 38364XB-GENE-485127Inparanoid, OMA
Zebrafish64272atp1b3bATPase Na+/K+ transporting subunit beta 3b7955ZDB-GENE-001127-1Inparanoid, OMA
C. elegans182726nkb-1Sodium/potassium-transporting ATPase subunit beta-16239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transporter    /    cation transporter    /    Sodium/potassium-transporting ATPase subunit beta-3
DTO Classes
protein    /    Transporter    /    P-type ATPases    /    Na+/K+-ATPases    /    Sodium/potassium-transporting ATPase subunit beta-3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.