🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

ATG13

DescripciónAutophagy-related protein 13

Gene and Protein Information

Gene ID9776
Uniprot Accession IDs O75143 B4DFI4 D3DQQ1 D3DQQ2 E9PQZ8 Q53EN6 Q9BRL3 Q9H8B0
Ensembl ID ENSP00000432412
Symbol KIAA0652 KIAA0652 PARATARG8
FamilyBelongs to the ATG13 family. Metazoan subfamily.
Sequence
METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451155ATG13autophagy related 139598VGNC:3206Inparanoid, OMA, EggNOG
Macaque714322ATG13autophagy related 139544Inparanoid, OMA
Mouse51897Atg13autophagy related 1310090MGI:1196429Inparanoid, OMA, EggNOG
Rat362164Atg13autophagy related 1310116RGD:1310685Inparanoid, OMA
Dog483632ATG13autophagy related 139615VGNC:38217Inparanoid, OMA, EggNOG
Horse100050734ATG13autophagy related 139796VGNC:15618Inparanoid, OMA, EggNOG
Cow507340ATG13autophagy related 139913VGNC:26251Inparanoid, OMA, EggNOG
Pig100516128ATG13autophagy related 139823Inparanoid, OMA, EggNOG
Opossum100011759ATG13autophagy related 1313616Inparanoid, OMA, EggNOG
Chicken423192ATG13autophagy related 139031CGNC:6324Inparanoid, OMA, EggNOG
Anole lizard100566276atg13autophagy related 1328377Inparanoid, OMA, EggNOG
Xenopus100125026atg13autophagy related 138364XB-GENE-960599Inparanoid, OMA, EggNOG
Zebrafish393405atg13ATG13 autophagy related 13 homolog (S. cerevisiae)7955ZDB-GENE-040426-1149Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.