Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Cyclic AMP-dependent transcription factor ATF-4 |
|---|
Gene and Protein Information
| Gene ID | 468 |
|---|---|
| Uniprot Accession IDs | P18848 Q96AQ3 Q9UH31 cAMP-dependent transcription factor ATF-4 |
| Ensembl ID | ENSP00000336790 |
| Symbol | CREB2 TXREB CREB2 TXREB CREB-2 TAXREB67 |
| Family | Belongs to the bZIP family. |
| Sequence | MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 744513 | ATF4 | activating transcription factor 4 | 9598 | VGNC:5227 | OMA, EggNOG |
| Mouse | 11911 | Atf4 | activating transcription factor 4 | 10090 | MGI:88096 | Inparanoid, OMA, EggNOG |
| Rat | 79255 | Atf4 | activating transcription factor 4 | 10116 | RGD:621863 | Inparanoid, OMA, EggNOG |
| Dog | 474503 | ATF4 | activating transcription factor 4 | 9615 | VGNC:38210 | Inparanoid, OMA, EggNOG |
| Horse | ATF4 | activating transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:786] | 9796 | OMA, EggNOG | ||
| Cow | 509107 | ATF4 | activating transcription factor 4 | 9913 | VGNC:26242 | Inparanoid, OMA, EggNOG |
| Pig | 100144302 | ATF4 | activating transcription factor 4 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012224 | ATF4 | activating transcription factor 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | ATF4 | activating transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:786] | 9258 | OMA, EggNOG | ||
| Chicken | 395693 | ATF4 | activating transcription factor 4 | 9031 | CGNC:9204 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100565177 | atf4 | activating transcription factor 4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448005 | atf4 | activating transcription factor 4 | 8364 | XB-GENE-983841 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.